garnier |
Secondary structure prediction is notoriously difficult to do accurately. The GOR I alogorithm is one of the first semi-successful methods.
The Garnier method is not regarded as the most accurate prediction, but is simple to calculate on most workstations.
The accuracy of any secondary structure prediction program is not much better than 70% to 80% at best. This is an early algorithm and will probably not predict with much better than about 65% accuracy.
The Web servers for PHD, DSC, and others are generally preferred.
Do not rely on this (or any other) program alone to make your predictions with. Use several programs and take a consensus of the results.
% garnier Predicts protein secondary structure Input sequence(s): tsw:amic_pseae Output report [amic_pseae.garnier]: |
Go to the input files for this example
Go to the output files for this example
Standard (Mandatory) qualifiers: [-sequence] seqall Sequence database USA [-outfile] report Output report file name Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: -idc integer In their paper, GOR mention that if you know something about the secondary structure content of the protein you are analyzing, you can do better in prediction. 'idc' is an index into a set of arrays, dharr[] and dsarr[], which provide 'decision constants' (dch, dcs), which are offsets that are applied to the weights for the helix and sheet (extend) terms. So, idc=0 says don't use the decision constant offsets, and idc=1 to 6 indicates that various combinations of dch,dcs offsets should be used. Associated qualifiers: "-sequence" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outfile" associated qualifiers -rformat2 string Report format -rname2 string Base file name -rextension2 string File name extension -rdirectory2 string Output directory -raccshow2 boolean Show accession number in the report -rdesshow2 boolean Show description in the report -rscoreshow2 boolean Show the score in the report -rusashow2 boolean Show the full USA in the report General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report deaths |
Standard (Mandatory) qualifiers | Allowed values | Default | |
---|---|---|---|
[-sequence] (Parameter 1) |
Sequence database USA | Readable sequence(s) | Required |
[-outfile] (Parameter 2) |
Output report file name | Report output file | |
Additional (Optional) qualifiers | Allowed values | Default | |
(none) | |||
Advanced (Unprompted) qualifiers | Allowed values | Default | |
-idc | In their paper, GOR mention that if you know something about the secondary structure content of the protein you are analyzing, you can do better in prediction. 'idc' is an index into a set of arrays, dharr[] and dsarr[], which provide 'decision constants' (dch, dcs), which are offsets that are applied to the weights for the helix and sheet (extend) terms. So, idc=0 says don't use the decision constant offsets, and idc=1 to 6 indicates that various combinations of dch,dcs offsets should be used. | Integer from 0 to 6 | 0 |
The meaning and use of the parameter 'idc' is currently being investigated. The original author, Bill Pearson writes:
"In their paper, GOR mention that if you know something about the secondary structure content of the protein you are analyzing, you can do better in prediction. "idc" is an index into a set of arrays, dharr[] and dsarr[], which provide "decision constants" (dch, dcs), which are offsets that are applied to the weights for the helix and sheet (extend) terms. So, idc=0 says don't use the decision constant offsets, and idc=1 to 6 indicates that various combinations of dch,dcs offsets should be used. I don't remember what they are, but I must have gotten the values from their paper."
ID AMIC_PSEAE STANDARD; PRT; 384 AA. AC P27017; DT 01-AUG-1992 (Rel. 23, Created) DT 01-DEC-1992 (Rel. 24, Last sequence update) DT 15-DEC-1998 (Rel. 37, Last annotation update) DE ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN. GN AMIC. OS Pseudomonas aeruginosa. OC Bacteria; Proteobacteria; gamma subdivision; Pseudomonas group; OC Pseudomonas. RN [1] RP SEQUENCE FROM N.A., AND SEQUENCE OF 1-18. RC STRAIN=PAC; RX MEDLINE; 91317707. RA WILSON S.A., DREW R.E.; RT "Cloning and DNA sequence of amiC, a new gene regulating expression RT of the Pseudomonas aeruginosa aliphatic amidase, and purification of RT the amiC product."; RL J. Bacteriol. 173:4914-4921(1991). RN [2] RP X-RAY CRYSTALLOGRAPHY. RX MEDLINE; 92106343. RA WILSON S.A., CHAYEN N.E., HEMMINGS A.M., DREW R.E., PEARL L.H.; RT "Crystallization of and preliminary X-ray data for the negative RT regulator (AmiC) of the amidase operon of Pseudomonas aeruginosa."; RL J. Mol. Biol. 222:869-871(1991). RN [3] RP X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS). RX MEDLINE; 95112789. RA PEARL L.H., O'HARA B., DREW R.E., WILSON S.A.; RT "Crystal structure of AmiC: the controller of transcription RT antitermination in the amidase operon of Pseudomonas aeruginosa."; RL EMBO J. 13:5810-5817(1994). CC -!- FUNCTION: NEGATIVELY REGULATES THE EXPRESSION OF THE ALIPHATIC CC AMIDASE OPERON. AMIC FUNCTIONS BY INHIBITING THE ACTION OF AMIR CC AT THE PROTEIN LEVEL. IT BINDS TO AMIR. IT EXHIBITS PROTEIN KINASE CC ACTIVITY. CC -!- SUBUNIT: HOMODIMER. CC -!- DOMAIN: CONSISTS OF TWO BETA-ALPHA-BETA DOMAINS WITH A CENTRAL CC CLEFT IN WHICH THE AMIDE BINDS. CC -------------------------------------------------------------------------- CC This SWISS-PROT entry is copyright. It is produced through a collaboration CC between the Swiss Institute of Bioinformatics and the EMBL outstation - CC the European Bioinformatics Institute. There are no restrictions on its CC use by non-profit institutions as long as its content is in no way CC modified and this statement is not removed. Usage by and for commercial CC entities requires a license agreement (See http://www.isb-sib.ch/announce/ CC or send an email to license@isb-sib.ch). CC -------------------------------------------------------------------------- DR EMBL; X13776; CAA32024.1; -. DR PIR; A40359; A40359. DR PDB; 1PEA; 03-APR-96. KW Transferase; Kinase; Repressor; 3D-structure. FT INIT_MET 0 0 SQ SEQUENCE 384 AA; 42704 MW; 68FF861F CRC32; GSHQERPLIG LLFSETGVTA DIERSHAYGA LLAVEQLNRE GGVGGRPIET LSQDPGGDPD RYRLCAEDFI RNRGVRFLVG CYMSHTRKAV MPVVERADAL LCYPTPYEGF EYSPNIVYGG PAPNQNSAPL AAYLIRHYGE RVVFIGSDYI YPRESNHVMR HLYRQHGGTV LEEIYIPLYP SDDDLQRAVE RIYQARADVV FSTVVGTGTA ELYRAIARRY GDGRRPPIAS LTTSEAEVAK MESDVAEGQV VVAPYFSSID TPASRAFVQA CHGFFPENAT ITAWAEAAYW QTLLLGRAAQ AAGNWRVEDV QRHLYDIDID APQGPVRVER QNNHSRLSSR IAEIDARGVF QVRWQSPEPI RPDPYVVVHN LDDWSASMGG GPLP // |
The output is a standard EMBOSS report file.
The results can be output in one of several styles by using the command-line qualifier -rformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: embl, genbank, gff, pir, swiss, trace, listfile, dbmotif, diffseq, excel, feattable, motif, regions, seqtable, simple, srs, table, tagseq
See: http://emboss.sf.net/docs/themes/ReportFormats.html for further information on report formats.
By default garnier writes a 'tagseq' report file.
######################################## # Program: garnier # Rundate: Fri Jul 15 2005 12:00:00 # Report_format: tagseq # Report_file: amic_pseae.garnier ######################################## #======================================= # # Sequence: AMIC_PSEAE from: 1 to: 384 # HitCount: 111 # # DCH = 0, DCS = 0 # # Please cite: # Garnier, Osguthorpe and Robson (1978) J. Mol. Biol. 120:97-120 # # #======================================= . 10 . 20 . 30 . 40 . 50 GSHQERPLIGLLFSETGVTADIERSHAYGALLAVEQLNREGGVGGRPIET helix HHHHHHHHHHHHHHHHHHH sheet EE EEEEE EEEE turns T TTTT coil CCCCC CCCCC C CCCC . 60 . 70 . 80 . 90 . 100 LSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADAL helix HHHHHH HHHH H HHHHHH sheet E EEEE EEEE EEEE E turns TT TT T TTTTT TTT T T coil C CCC . 110 . 120 . 130 . 140 . 150 LCYPTPYEGFEYSPNIVYGGPAPNQNSAPLAAYLIRHYGERVVFIGSDYI helix HHH sheet EEE E EE E EEEE EEEEE turns T TTT TT T TT TT T TTTT coil CCC CC CCCCC CCC C C . 160 . 170 . 180 . 190 . 200 YPRESNHVMRHLYRQHGGTVLEEIYIPLYPSDDDLQRAVERIYQARADVV helix HHHH HHHHHHHHHHHHH sheet EEE EEEEEEE EEEE turns TTT TTT TTTT coil CC C CCCC CC . 210 . 220 . 230 . 240 . 250 FSTVVGTGTAELYRAIARRYGDGRRPPIASLTTSEAEVAKMESDVAEGQV helix HHHHHHH HHHHHHHHHHHHHHHHH sheet EEEE EE EEE E turns TTTTTT coil CCCCC CCC CC . 260 . 270 . 280 . 290 . 300 VVAPYFSSIDTPASRAFVQACHGFFPENATITAWAEAAYWQTLLLGRAAQ helix HHHH HHHHHHHHHHHHH HHHH sheet EEEE E EE E turns TTT T T TTT TT coil CCC C CCC C CCC . 310 . 320 . 330 . 340 . 350 AAGNWRVEDVQRHLYDIDIDAPQGPVRVERQNNHSRLSSRIAEIDARGVF helix HHHHHHH HHH sheet E EEEE EEEEE EEE EE turns TT T TT T TTT coil CCCCCC C CCC CCC CCC . 360 . 370 . 380 QVRWQSPEPIRPDPYVVVHNLDDWSASMGGGPLP helix sheet EE EEEEEEE E turns TT TT TTT TTT coil CCCC CCC C C CCCCC #--------------------------------------- # # Residue totals: H:111 E: 98 T: 81 C: 94 # percent: H: 30.2 E: 26.6 T: 22.0 C: 25.5 # #--------------------------------------- |
The Web servers for PHD, DSC, and others are generally preferred.
Do not rely on this (or any other) program alone to make your predictions with. Use several programs and take a consensus of the results.
The 3D structure for the example sequence is known, although the 2D structure elements were not in the SwissProt feature table for release 38 when the test data was extracted.
DSSP shows:
From To Structure 9 13 E beta sheet 21 39 H alpha helix 50 54 E beta sheet 60 72 H alpha helix 78 81 E beta sheet 85 97 H alpha helix 101 104 E beta sheet 117 119 E beta sheet 128 136 H alpha helix 142 148 E beta sheet 151 166 H alpha helix 170 177 E beta sheet 183 196 H alpha helix 200 204 E beta sheet 208 221 H alpha helix 229 231 E beta sheet 236 239 H alpha helix 244 247 H alpha helix 251 254 E beta sheet 263 273 H alpha helix 284 303 H alpha helix 308 315 H alpha helix 320 322 E beta sheet 325 329 E beta sheet 336 337 E beta sheet 341 345 E beta sheet 351 356 E beta sheet
You are advised to use several of the latest Web-based prediction sites and combine them to make a consensus prediction.
Program name | Description |
---|---|
helixturnhelix | Report nucleic acid binding motifs |
hmoment | Hydrophobic moment calculation |
pepcoil | Predicts coiled coil regions |
pepnet | Displays proteins as a helical net |
pepwheel | Shows protein sequences as helices |
tmap | Displays membrane spanning regions |
This application was modified for inclusion in EMBOSS by
Rodrigo Lopez (rls © ebi.ac.uk)
European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK